PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_011368-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 504aa    MW: 56399.6 Da    PI: 9.989
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_011368-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.41.6e-081349340
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     rW t+E+++l  av ++G+++W+++a +++ +Rtl+ c
  AHYPO_011368-RA 13 RWGTWEELILGGAVLRHGSHNWDAVALELQ-TRTLYPC 49
                     9*****************************.****977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002493.7E-61347IPR001005SANT/Myb domain
SuperFamilySSF473702.62E-20266388IPR001487Bromodomain
Gene3DG3DSA:1.20.920.105.9E-17273395IPR001487Bromodomain
SMARTSM002973.8E-16285389IPR001487Bromodomain
PfamPF004398.7E-13294373IPR001487Bromodomain
PROSITE profilePS5001410.401300370IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MVEERKEGND CVRWGTWEEL ILGGAVLRHG SHNWDAVALE LQTRTLYPCL FTPQVCKAKY  60
EVLQERYSGC SAWVEDLRRK RVNELRKELE KSEESIGSLE WKLETLKSEK AVCVYADQGC  120
SAAESLEPLL KSGGNESAGK EASRDGSSAA SFSQEAYTSR LLHCRAAATE ECDRKPVAPE  180
PFLSLEKFSG IDKYGVNFRR KRGKRRRKDL NKDGKEGSVD DQNNLMSLPD TMSPTSPASQ  240
AKEKLTSDTM HPVKSPDADC QDPCTSMQTH PVRTPVADDQ KPCMRMQEIV DFVKIFDFVM  300
KNDHASVFRR RLDSQKRARY KRIIRQHLDL DTIESRIANK CITSTVQLLR DLLLLANNAL  360
VFYSKSTREY KCALILRDLV TKIVHQHHKA SDKKVVIAAV SETRKSPILK PPAKPRSARP  420
FNCKLFNKVV DSTPGDATIV AMKARIRPAG GNSTPSSAES PALTKKSQGK RGKVGRVKRG  480
NAGIQAETPM KVRKRVKSEI VEL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198208RRKRGKRRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010696581.10.0PREDICTED: uncharacterized protein LOC104909087 isoform X1
TrEMBLA0A0J8BA490.0A0A0J8BA49_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42150.12e-13DNA-binding bromodomain-containing protein